Lrl

hi there, does anyon know difference between dfs-r , windows server migration tool on windows 2012? plan move user share folders new ucs, best way me keep shares , ntfs permission? dfs-r or windows server migration tool? also, windows server migration tool replace file server migration tool in windows 2012 , "only" come powershell, no gui use? please help!!! hi, >>does anyon know difference between dfs-r , windows server migration tool on windows 2012? windows server migration tools allows administrator migrate server roles, features, operating system settings, shared folders, , other data computers running editions of windows server 2003, windows server 2008, windows server 2008 r2, or windows server 2012 computers running windows server 2012. the distributed file system replication (dfsr) service new multi-master replication engine used keep folders synchronized on multiple servers. regarding windows server migration tools, following articles c...

hi, trying achieve following objective. login each esx 4.1 host , backup configuration. my script follows: when i step through, fails line 14. i following error: i can see reason $s variable not being passed through command. leaving $s. i can see variable working fine other lines 11, 12, and 16 any welcomed. hi, you cannot pass ip address to get-vmhostfirmware -vmhost. instead need pass hostname , work charm. thanks, rohith Windows Server  >  Windows PowerShell

i have installed kms 1.1 windows server 2003 on 1 of domain controllers (test environment mirrors production), , after reboot following error: logon message system cannot log on due following error: specified domain either not exist or not contacted. please try again or consult system administrator. if wait 8 minutes after rebooting able log in , problem seems go away until reboot again.  when run dcdiag passes.  worked fine prior installing kms , uninstalling kms doesn't return host normal, still same error. know what's this?  don't want in production until know works in test.  followed step-by-step instructions in doc install kms on 2003 fyi. yep, it.  reason domain controllers pointed @ dns - there no secondary entry pointing @ other dc dns installed.  once added second dns server , rebooted, error message went away.  it's odd problem appeared after installing kms though. Windows Ser...

hello, encountered problem statvfs() system call in sua 6.1 (windows server 2008 r2 64-bit, sua sdk version november 2010). returns errno 88 (value large stored in data type). following program illustrates problem (compile gcc): #include <fcntl.h> #include <sys/statvfs.h> #include <stdio.h> #include <errno.h> #include <string.h> int main( int argc, char * argv[]) { struct statvfs statvfsdata; int rc = statvfs( "/dev/fs/c/" , &statvfsdata); if (rc != 0) { printf( "error statvfs(): errno = %d (%s)\n" , errno, strerror(errno)); switch ( errno ) { case eoverflow: printf( "eoverflow: file size in bytes or number of blocks allocated file or file serial number cannot represented correctly in structure pointed buf.\n" ); break ; } exit(1); } printf( "fs id = %d\n" , statvfsdata.f_fsid); } output of program is: $ ./...

still trying more information on getting sha256 root ca certificate signed sha1 root ca (temporarily), , having non-windows entities recognize that: creating cross-certification between 2 root ca's within same organization (one hierarchy sha1 , other sha256) and distributing crossca certificate painless enough forest members because gets published ad , comes down forest member certificates store (trusted intermediary).  best way get non-windows end entities recognize crossca certificate?  rfc ( http://tools.ietf.org/html/ rfc5280#section-4.2.2.1 ) states can configure aia extension point collection of certificates, means (unless missing something) need modify aia extensions configuration on sha256 root ca point pkcs7 container on http location, issue sha256 subca certificates subordinate ca's.  way when sha256 subordinate ca's issue end entity certificates non-windows entities the chain of trust go sha1 root ca. both hierarchies 2-tier. ...

i have server running ws2008, i've tried deploying printer 32-bit xp , w7 clients have problems finding 32-bit driver. is there way send print jobs server , have server print them? because can print fine server. thanks alexgeek.co.uk - web design , development blog you need add 32-bit drivers on ws2008. go printer properties on server - select sharing tab - select change sharing options - select additional drivers... add 32-bit drivers. michael Windows Server  >  Print/Fax

hi folks, intention:-migrating on premise site collection sharepoint online. is there power-shell script or list availabe products. please give idea , let me know script. thanks, hi jio333， this issue has been discussed in sharepoint forum: sharepoint 2013 - migrate sharepoint 2013 on premise sharepoint 2013 cloud        to complete kind of migration task, use 3rd party tools because have complex migration requirements. if there else regarding issue, please feel free post back. if have feedback on our support, please click  here . best regards, anna wang technet community support                       please remember mark replies answers if , unmark them if provide no help. if have feedback technet support, contact tnmff@microsoft.com Win...

how supposed enjoy new windows 10 features if of sudden our working sound , mic went south appearance of gwx? have checked everywhere , tried everything. speaker has gone high def audio conexant smartaudio hd, , microphones show "not plugged in" no way try enable or test, or set @ default since grayed out. have tried uninstalling sound, games, webcam, shutting down , restarting -- no change. tried downloading driver manufacturer , installing , restarting system -- no change, tried system restore earlier point when know sound working -- no change, of sudden conexant smartaudio device isn't being recognized "built-in" laptop, looking plugged in.  laptop has own built-in mic worked great until yesterday after gwx, , has great chicony 2.0 usb webcam built-in has great mic (or @ least had great 1 until yesterday) , neither of these mics being detected built-in or plugged in, message in playback windows microphone not plugged in , rest greyed out! funny thing....

This summary is not available. Please click here to view the post.

folks, i'm new group policy preferences , having difficult time getting them work properly. here's setup: windows xp sp3 clients (so understanding should have cse installed) windows 2003 sp2 - ad (native mode) windows 2008 server used configure gpp > xp clients in ou linked gpo has gpp settings. > old fashion group policies settings work flawlessly (pre-2008) here's gpp settings (and problems): 1. user configuration\preferences\windows settings\registry     - action: delete     - hive: hkey_current_user     - key path: software\microsoft\internet explorer\settings     - value name: <name of value want delete>     so, here's problem: it's not deleting reg_sz. i've tried creating pref in "computer configuration\.." , still no dice. 2. user configuration\preferences\windows settings\registry     - action: create     - hive: hkey_current_user     - key path: software\microsoft\office\11.0\outlook\options\mail     - value name: junkmailimportlis...

hello! windows server 2008 r2 domain controller hardware server can install hyper-v role on domain controller? are there restriction in installation? yes can not recommended make dc holder of other roles ad:ds , dns in case of need reboot dc, need shut down virtual machines before that. , there security issue because other people may need direct access dc , may break. however, hyper-v uses more 1 nic whihc may cause issue on dc (multihomed dc) i not recomment using hyper-v role on dc @ all. use server regards, krzysztof ---- visit blog @ http://kpytko.wordpress.com Windows Server  >  Directory Services

hi, while off site, our engineers used set static ip in machine link customer devices , forgot change ip setting dynamic when in office. at times, their static ip address conflict with our server ip. any suggestion to prevent such problem happening ?  thanks mark hello, without removing them permission configure networking not possible. assume local admins, not possible? best regards meinolf weber disclaimer: posting provided "as is" no warranties or guarantees , , confers no rights. Windows Server  >  Network Infrastructure Servers

some webpage has unordered list (<ul><li>...</li></ul>). when click to select item, navigate page. how can use powershell similar following? $ie = new-object -com internetexplorer.application  $ie.visible = $true $ie.navigate(" http:// www.awebsite.com ") start-sleep -seconds 2 .... $signout = $ie.document.getelementsbytagname('a') | where-object {$_.innertext -eq 'sign out'} $signout.click() just found workaround using $ie.document.getelementsbytagname('a')) | where-object, spend lot of time try & error Windows Server  >  Windows PowerShell

my present server runs server 2003 enterprise sql server 2000. overkill our 5 person office. unfortunately previous person not return os or sql disks (pirate?). sql server backend access 2003 database, , intranet calendar. no more 3 concurrent users databases. server roles fileserver, sql server, , intranet webserver. question: can run sbs 2008 standard sql server express 2008? or need premium edition? need purchase cals express edition? can expect migration issues going sql server 2000 sql server express 2008? sql server replaced .mdb backend because available. no triggers, stored procedures, etc. hi there, your question more related sql server , need post under sql forum engineers answer question in more precise way http://social.technet.microsoft.com/forums navigate sql server forum best of luck sainath windows driver development Windows Server  >...

hi all,    my domain domain.com , has been since before time. our web server www.domain.com . people today becoming accustomed to entering domain in browser url go site. works fine for external users, on internal network entering domain.com go domain controller and 'under construction' page or time out. far understand ad , dns there isn't way 'fix' aside creating new ad domain (not an really option) or changing our www.domain.com else (not an option)...is right? there or better way deal this? thanks, mike hi all,    my domain domain.com , has been since before time. our web server www.domain.com . people today becoming accustomed to entering domain in browser url go site. works fine for external users, on internal network entering domain.com go domain controller and 'under construction' page or time out. far understand ad , dns there isn't way 'fix' aside creating new ad domain (not an really ...

hi, i have got fileserver vm shared folder f:\ hosted on hyper-v-1. want have availability on shared folder, whenever fileserver goes down f:\ drive move automatically vm hosted on hyper-v2. how can achieve setup. regards,  hi, i have got fileserver vm shared folder f:\ hosted on hyper-v-1. want have availability on shared folder, whenever fileserver goes down f:\ drive move automatically vm hosted on hyper-v2. how can achieve setup. regards,  you need build clustered file server. see: clustered file server https://technet.microsoft.com/en-us/library/cc753969(v=ws.11).aspx ...or shared nothing smb3 file server https://www.starwindsoftware.com/blog/part-2-smb-3-0-file-server-on-free-microsoft-hyper-v-server-2012-r2-clustered you can use shared storage make sure before you'll jump on shared vhdx bandwagon you'll approval backup vendor - can handle shared vhdx or not. make sure you're ok not move / resize etc shared vhdx. see: shared vhdx ...

i'm looking following. i have 2 forests 1 call old , 1 new. old contains 1 domain old.local , new new.local. want move old.local same forest new.local best way , impact on file share permissions etc. old.local must retain original name when moved new forest. simply cannot move domain new forest. however, can following: create new domain in new forest has different dns , netbios name old domain use admt migrate ad objects old domain 1 recommended creation finish migration , rename new domain: https://technet.microsoft.com/en-us/library/cc738208%28v=ws.10%29.aspx?f=255&mspperror=-2147217396 this posting provided no warranties or guarantees , , confers no rights. ahmed malek my website link my linkedin profile my mvp profile Windows Server  >  Direc...

i have tried possible settings screensaver not appear on win 7 desktop : here technet referred screen saver settings gets disabled not apply .scr file . http://technet.microsoft.com/en-us/library/ee617164(ws.10).aspx anand shankar hi, thanks posting. this known issue, please check kb article: win7/w2k8 r2 group policy screensaver setting not working http://support.microsoft.com/kb/2616727 regards. vivian wang technet community support Windows Server  >  Group Policy

hi there, my company planning deploy windows server 2003 enterprise edition. before using standard edition. we in terminal server environment clients access applications installed on server side. my question is, can able use same softwares in enterprise edition used in standard edition? such microsoft office 2007 volume license used in win server 2003 standard edition. thank you tom  hi, this group specific terminal services on windows server 2008.  terminal services newsgroup better place answer question: http://www.microsoft.com/communities/newsgroups/en-us/default.aspx?dg=microsoft.public.windows.terminal_services&cat=en_us_9d749b6a-5138-4a90-ba10-031318c00d76&lang=en&cr=us Windows Server  >  Remote Desktop Services (Terminal Services) ...

hi, du have hint me. tried replace existing wsus (2012r2) server 2016. working until changed port 80 (wsusutil usecustomwebsite false). after clients show in console dont report. i set clean test environment dc (a win 7, 8.1, 10 , server 2012 r2 clients) there not work after chage port 80. does know fix ? thanks hi, i suggest add additional binding 80 because changing 8530 80 break wsusutil checkhealth instance. i changed default website 81, added 80 wsus administration. (there bug in iis manager prevent adding binding. have type in host name field , delete allow press ok…) Windows Server  >  WSUS

hi,   i have ad 2008 r2 sp1, , configured domain users nonmembers of local administrators group on machines,   now problem normal domain users didn’t have access : - defrag local disk drives - scan local disk drives - install drivers required when connect usb flash disk   as client xp sp2 , sp3,   so need solution enable domain users above tasks, trace gpo in windows server 2008 r2, found of applied @ least windows vista not xp,   we appreciate productive idea, tamer tawfik almoayyed computers hi, try setup schedulded task (defrag) , set run using administrative credentials. deploy task using group policy preferences. should work fine. check if have trouble setting up http://technet.microsoft.com/en-us/library/cc725745.aspx hope helps. mcts... Windows Server  >  ...

hi , i have install windows media player streaming in windows server datacenter 2008 i not found function "desktop experience " on list of available functionnalities if right-click features > add or run major windows update can please me on issue ? urgent  thanks  from command or powershell window issue command. c:\ dism /online /enable-feature /featurename:inksupport c:\ dism /online /enable-feature /featurename:desktopexperience feature names case-sensitive.  require reboot of system. .:|:.:|:. tim Windows Server  >  Windows Server 2012 General

hi all. im new in it. want install wds on server 2993 r2 fresh install please tell me steps it. mean dhcp, dns etc etc. , regards  please reply me possible. some here. http://technet.microsoft.com/en-us/library/cc766320(v=ws.10).aspx http://blogs.technet.com/b/askcore/archive/2007/10/21/how-to-set-up-windows-deployment-services-on-2003-sp2-servers-for-installs-of-windows-2003-and-xp.aspx       regards, dave patrick .... microsoft certified professional microsoft mvp [windows] disclaimer: posting provided "as is" no warranties or guarantees , , confers no rights. Windows Server  >  Setup Deployment

hi guys i setting windows 2008 r2 cluster,  i using iscsi shares disks. disk management shows me when set disks first time but because setting cluster need shutdown 1 of servers , once server stars disk assignment changes can see below, found out when restart server happens too comparison below initial setup     after restart disk 1 - datos - e   disk 1 - tempdb - h bus number 0, target id 0, lun 0   bus number 0, target id 4, lun 0       disk 2 - logs - f   disk 2 - bk - g bus number 0, target id 1, lun 0   bus number 0, target id 3, lun 0       disk 3 - bk - g   disk 3 - quorum - q bus number 0, target id 2, lun 0   bus number 0, target id 0, lun 0       disk 4 - tempdb - h   disk 4 - datos - e bus number 0, target id 3, lun 0   bus number 0, ...

good   day   i need add   new   address   to hosts file   of users and   i can do   this procedure by a   gpo.   it applies   per user   or computer . thanks help. hello, if can replace existing hosts file "master" host file, gpo. (gpp cse named "files") if need keep current entries in hosts file, need script this. use start script appends new line hosts file. need check, if value in hosts file, otherwise add new line on every reboot. mvp group policy - mythen, insiderinfos und troubleshooting zum thema gpos: http://matthiaswolf.blogspot.com/ Windows Server  >  Group Policy

hi all, i've signed ps script. run script using web page (iis , ie both on same testing server). following error: file d:\get-process.ps1 cannot loaded because execution of scripts disabled on system. please see "get-help about_signing" more details. now i've set execution policy unrestricted (just testing) still same issue!. any ideas? script runs fine locally ps command. no luck :( let me put way, i've changed allsigned unrestricted.  works on ps command line browser (on same server) still getting same error. very strange. so assuming have signed script (there should signature @ end of script)..something below @ end of script <!-- sig # begin signature block --> <!-- miixxayjkozihvcnaqccoiixttccf0kcaqexczajbgurdgmcgguamgkgcisgaqqb --> <!-- gjccaqsgwzbzmdqgcisgaqqbgjccar4wjgidaqaabbafzdtgwusitrck0sypfvnr --> <!-- ageaageaageaageaageamcewcqyfkw4dahofaaququhixmxclxkcftxrnl0nlf4b --> test way...... on admin console...

when configuring remote desktop profile in mac's microsoft remote desktop,  i set full screen mode osx native after closing , re-opening app, automatically changes custom.   how resolve this? hi, in order better troubleshoot issue, please tell version of remote desktop mac? please ensure latest version of remote desktop mac installed: https://itunes.apple.com/gb/app/microsoft-remote-desktop/id715768417?mt=12 in addition, please try install remote desktop mac beta application below see whether has same issue: http://aka.ms/rdmac-preview best regards, amy please remember mark replies answers if , unmark them if provide no help. if have feedback technet subscriber support, contact tnmff@microsoft.com . Windows Server  >  Remote Desktop clients ...

hi, how can find out dns server, dfs server , dhcp servers in ad domain? there script, free tool or query can me data? hi, how can find out dns server, dfs server , dhcp servers in ad domain? there script, free tool or query can me data? hello mr. rajkumar, apparently multi-posted nis forum. can moderator merge threads? thank you! http://social.technet.microsoft.com/forums/en-us/winservernis/thread/7eafc1cd-34e6-42cf-85df-ff7b33f49e1a . in meantime, convenience, here response in other thread: to find dns servers in forest or domain, here few methods: nltest command: nltest /dnsgetdc:<forestname.com> nltest /dnsgetdc:<domainname.com> . nslookup command: nslookup set ns domain.com this list nameserver records authoritive domain. may not 100% accurate, depending if there old servers in nameserver list may have been orphaned, ips changes, etc, , weren't cleaned up. run dnslint first check nameserver accura...

i can use mmc / certificates , request certificates users, computers, , servers templates have enabled on windows 2008 issuing ca server. is there way create signed certificate by my mmc / certificate authority , apply server without having server make request, (csr), first?     the process of generating certificate requires steps of creating certificate request , submitting request ca. using certificate manager mmc snap-in on client or server request certificates enterprise ca performing 2 steps described above part of process. if server requesting the certificate is not domain member, necessary manually transfer request (csr) ca , process generate valid certificate. /hasain   Windows Server  >  Security ...

this cousin computer. windows vista home edition.  my nephews told not download teenagers do wherever they want computer keeps shutting down . keeps saying must shut down protect itself.  i cant restore or because keeps shutting down.  its says something about internet explorer shut down , down goes. please help do have backup disk can reload factory? doing before shuts down? have ran anti-virus software on yet? malware-bytes 1 use. try putting te pc insafe mode , running software. ccleaner tool download , run. basic clean registry clean on it. if not sure how put pc in safe mode, have google brand of pc. luck.  Windows Server  >  WSUS

i have newly installed windows server 2008 installation 32 bit running service pack 2 , latest updates, whenever go control panel explorer.exe crashes. problem signature:   problem event name:    appcrash   application name:    explorer.exe   application version:    6.0.6002.18005   application timestamp:    49e01da5   fault module name:    stackhash_762f   fault module version:    6.0.6002.18005   fault module timestamp:    49e03821   exception code:    c0000374   exception offset:    000afaf8   os version:    6.0.6002.2.2.0.16.7   locale id:    3081   additional information 1:    762f   additional information 2:    42ddeacd6c2fc5ff1448a65d7ef5bb0f   additional information 3:    d329   add...

all, i have domain have migrated sbs new, full ad domain.  1 of features of sbs rely on heavily , anywhere access, website can log in , connect through rdp systems.  functionality exists in sbs or windows server 2012 essentials not available in same form in windows server 2012 standard/datacenter.  option have implement remote desktop services have done.  have 2 options.  1.  can go rdweb site , select connect pc , allows me type in system name.  not option because of horrible unknown publisher security prompt users confronted each , every time try use system.  there not way around rdp file being generated on fly clients system , there unknown , not trusted.  2.  thought create remoteapp , publish rdp in fact 1 of options , not have such panic inducing security dialog rather information make sure trust system type of message.  problem scenario not prompt me system connect , default connects me rd gateway server.  kn...

running 2 2008 r2 clustered print servers.  have workstation able install printers 1 resource not other.  failing resource returns 0x6 invalid handle on printer try install.  other workstations have tested not experiencing issue.  i able add printer using local port option, attempts aside connect share not work.  any ideas?  thanks. hello, did research have not yet found solid solution. suggest try common troubleshooting steps. delete contents of following folders , restart spooler service. c:\windows\system32\spool\printers c:\windows\system32\spool\drivers backup , delete registry key: hkey_local_machine\system\currentcontrolset\control\print\monitors. refer microsoft kb article below. when try print, error message reports, 'test page fail print handle invalid' http://support.microsoft.com/kb/287284 if still no luck, suggest reinstall windows scratch on client machine. thanks zhang ...

we have 3 dcs, 2 @ our hq, , 1 @ our dr site. 2 dcs @ our hq server 2008 r2 sp1 standard,  1 dc @ our dr site server 2008 sp2. whenever try create new dns record on either 1 of 2 dcs @ our hq following error: dns --------------------------- host record testing.ourdomain.local cannot created. refused --------------------------- ok    i checked event viewer , found following: event id 4015 - dns-server-services dns server has encountered critical error active directory. check active directory functioning properly. extended error debug information (which may empty) "0000051b: atrerr: dsid-030f1f8d, #1: 0: 0000051b: dsid-030f1f8d, problem 1005 (constraint_att_type), data 0, att 20119 (ntsecuritydescriptor)". event data contains error. dcdiag /test:dns results on 3 dcs , 2 dcs @ hq can't create dns records on both pass without errors.   1 server @ our dr site 1 throws errors , errors follow: ___________________________________...

hi, i have 2 node windows 2008 datacenter r2 +sp1 failover cluster, vhds located on csv. i rebooted 1 node of cluster, vms failed on node2... except 1.   it gave me event event id 21502 'virtual machine apps server' failed start. 'apps server' failed restore. (virtual machine id ff5fb4fc-b73f-47e2-aa68-153283ca5cb8) 'apps server' microsoft synthetic scsi controller (instance id {a161c8af-b7d6-44b1-8ca9-e32cca8613a3}): failed restore error 'general access denied error' (0x80070005). (virtual machine id ff5fb4fc-b73f-47e2-aa68-153283ca5cb8) 'apps server': hyper-v virtual machine management service account not have permission open attachment '\\?\mpio#disk&ven_hp&prod_hsv200&rev_5000#1&7f6ac24&0&3630303530384234303030363841433230303030463030303032394630303030#{53f56307-b6bf-11d0-94f2-00a0c91efb8b}'. error: 'general access denied error' (0x80070005). (virtual machine id ff5fb4fc-b73f-4...

i developing script installs printers based on input csv file.  file works great long first time being run.  having trouble in cases running script on computers have 1 or more printers or printer ports installed trying install script. so trying generate if test see if various printers , printer ports present. here little test script have created trying see if given printer port installed: ------- $portname = "10.1.2.68_1" $ports = get - wmiobject - class win32_tcpipprinterport | select - object name if ( $ports -contains $portname ) { write - host "found port" $portname } else { write - host "didn't find" $portname } ------- if run "get-wmiobject -class win32_tcpipprinterport | select-object name" on computer, output: name ---- 10.1.2.68 10.1.2.68_1 however, when run first script on computer, receive message "didn't find 10.1.2.68_1". i presume problem $ports var...

hi, my name jacques. trying create image of server 2008 r2 ask me add roles , features correct when acces server manager panel cannot add roles features. replies " error: cannot display data until computer restarted." tried restart several times still doesn't work tried several other solutions still not work.  can me solve please? check : http://social.technet.microsoft.com/forums/windowsserver/en-us/71843f03-4589-4a36-a154-989f5db1e564/roles-and-features-error-cannot-display-data-until-computer-is-restarted-but-restart-does-not?forum=winservermanager http://www.asheville-computer-repair.com/index.php/2009/12/21/cant-add-roles-features-and-cant-run-windows-update-on-2008-r2/ arnav sharma | facebook | twitter please remember click “mark answer” on post helps you, , click “unmark answer” if marked post not answer question. can beneficial other community members reading thread. ...

in trying save more photos cdrw disk, deleted old files/photos.  can these back?  if so, how? i've heard of people being able recover lost photos/files magnetic disk, i've not heard of doing on laser media.  best bet contact disk recovery service , ask them.  aren't cheap, if photos important, it's worth looking into.   tgc   Windows Server  >  Windows Server General Forum

we're using symantec endpoint protection antivirus , considering switch system center endpoint protection.  one feature of sep need replace device control policies. in sep, have configured block usb devices class, except explicitly allow.  we add policy's exception list hardware id of device wish allow.  when new usb device plugged in computer, if hardware id doesn't match 1 on exception list, device disabled , user sees popup informing them of this.   this great cases when user brings in flash drive home , plugs computer.  sep disables device , prevents access drive.  some users need flash drives though, issue encrypted flash drives users.  because have set policy allow devices matching specific hardware id, when user plugs in 1 of our encrypted flash drives device installed , operates normally.  i have been told can accomplish same thing using group policy, i'm not sure if that's correct.  as @ description of relevant policies, ap...